SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000002572 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000002572
Domain Number 1 Region: 123-332
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-53
Family DBL homology domain (DH-domain) 0.00000148
Further Details:      
 
Domain Number 2 Region: 319-486
Classification Level Classification E-value
Superfamily PH domain-like 2.58e-32
Family Pleckstrin-homology domain (PH domain) 0.0054
Further Details:      
 
Domain Number 3 Region: 604-705,782-808
Classification Level Classification E-value
Superfamily SH2 domain 4.97e-24
Family SH2 domain 0.00086
Further Details:      
 
Domain Number 4 Region: 731-810
Classification Level Classification E-value
Superfamily SH3-domain 4.62e-19
Family SH3-domain 0.0009
Further Details:      
 
Domain Number 5 Region: 1-154
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.18e-16
Family Calponin-homology domain, CH-domain 0.03
Further Details:      
 
Domain Number 6 Region: 519-599
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000394
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000002572   Gene: ENSPCAG00000002691   Transcript: ENSPCAT00000002728
Sequence length 814
Comment pep:novel genescaffold:proCap1:GeneScaffold_4946:8009:140894:-1 gene:ENSPCAG00000002691 transcript:ENSPCAT00000002728 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
AQNKGIRPFPSEETAENDDDVYRSLEELADEHDLGEDIYDCVPCEDEGDDIYEDIIKVEV
QQPMVKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPGDMAAIFTNL
EDLIKVHHSFLRAIDLSMMAGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQLLAGR
EDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSTDRPEREQLKEALE
AMQDLAMYINEVKRDKETLKKISEFQSSIENLQVKLEEFGRPKIDGELKIRSTANHAKQD
RYLFLFDKVVIVCKRKGYSYELKEIIELLSHKMTDDPMNNKDIKKDHAAHWSYGFYLIHL
QGKQGFQFFCKTGDMKRKWMEQFEMAMSNIKPDKATANHHSFQMYTFDKTTNCKACKMFL
RGTFYQGYLCSKCGVGAHKECLEVMPPCKIRSMGMWDASGAGPGPKMVAVQNYHGNPAPP
GKPVLTFQMGDVMELLRGDPESQWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPMSRPPSR
ETDYTAYPWFAGSMERQQTDNLLKAHASGTYLVRERPAEAERFAISIKFNDEVKHIKVVE
KDSWIHITEAKKFESLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERVVCRASSRSPAS
CASYNFSFLSPQGLSFASHGSSTPFWSVFTPRVIGTAVARYNFAARDMRELSLREGDVVK
IYSRIGGDQGWWKGEASGRVGWFPSTYVEEEGIQ
Download sequence
Identical sequences ENSPCAP00000002572 ENSPCAP00000002572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]