SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003427 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003427
Domain Number 1 Region: 216-487
Classification Level Classification E-value
Superfamily L domain-like 1.36e-50
Family Internalin LRR domain 0.017
Further Details:      
 
Domain Number 2 Region: 543-847
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.75e-33
Family Rhodopsin-like 0.0051
Further Details:      
 
Domain Number 3 Region: 46-144
Classification Level Classification E-value
Superfamily L domain-like 1.25e-22
Family Ngr ectodomain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003427   Gene: ENSPCAG00000003639   Transcript: ENSPCAT00000003654
Sequence length 906
Comment pep:novel genescaffold:proCap1:GeneScaffold_3636:19662:140120:1 gene:ENSPCAG00000003639 transcript:ENSPCAT00000003654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTSWLCMLLSLPILLQLVSGGGSQKPGGPPRGCPAHCQCEPDGRMLLRVDCSDLGLSEL
PSNLSVFTSYLDLSMNNISRLPPSPLHSLRFLEELRLAGNSLTYIPKGAFAGLYSLKVLM
LQNNQLRQVPTEALQNLRSLQSLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLHNNRIHSLGKKCFDGLHSLETLD
LNYNNLDEFPTAIKTLSNLKELGFHSNNIKSIPEKAFVGNPSLITIHFYDNPIQLVGSSA
FQHLPELRTLTLNGASQITEFPDLTGTANLESLTLTGAQISSLPQTVCDQLPNLQVLDLS
YNRLEDLPSFSVCQKLQKIDLRHNEIWEIKVDTFQQLFSLRALNLAWNKIAIIHSNAFST
LPSLIKLDLSANCLSSFPVTGLHGLTHLKLTGNHALQSLISSENFPELKVIELPYAYQCC
AFGVCENVYKMSNQWNKGDNSTVDDLHKKDAGLFHVQDERDLEDFLFDFEEDLKALHSAQ
CSPSPGPFKPCEYLFGSWLIRIGVWTIAILALACNALVTSTVFRFPLYISSVKLLVGLIA
AVNMLTGVSSAVLAGVDAFTLGVFAQYGAWWEKGVGCQLLGFLSIFASESSVFLLTLAAL
ERGFSVKCSVKFETKTFSSLKGIILLCVLLALTVASVPLLGGSEYSASPLCLPLPSGEPS
TTGYMVALVLLNSLCFLVMTVAYTKLYCSLEKGELENIWDCSMVKHIALLLFTNCILYCP
VAFLSFSSLLNLTFISPEVIKFILLVIVPLPACLNPLLYILFNPHFKEDLASLGKQAHSW
TRSKHSSLMSINSDDVEKRSCDSTQALVTFTSASIAYDLPSGSSSSSAYPMTESCHLSSV
AFVPCL
Download sequence
Identical sequences ENSPCAP00000003427 ENSPCAP00000003427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]