SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003595 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003595
Domain Number 1 Region: 575-733
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-46
Family SPRY domain 0.0000193
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily DEATH domain 1.04e-21
Family Pyrin domain, PYD 0.0023
Further Details:      
 
Domain Number 3 Region: 353-415
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000427
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003595   Gene: ENSPCAG00000003731   Transcript: ENSPCAT00000003829
Sequence length 740
Comment pep:novel genescaffold:proCap1:GeneScaffold_1430:9683:21115:-1 gene:ENSPCAG00000003731 transcript:ENSPCAT00000003829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTLSDHLLNSLEELVPYDFEKFKFKLQNSSLEKEYSRIPRGLLLMARPVKLASLLINH
YGERDAVQLTLQVLRGINQRLLAEELHKAIGQDCPVQESGSDSSAVSGSSVENKPKSLKI
SDGLECDDSSPSGEGRAGLQSGQPDAGRGPQKKSQDRWKDQSLEWQGKPGARSMTPPSRK
GPALGQAREKGHLNFQMRRNANSTGRLQGLSSNSFCGTLGKREFKTAEKKKRPKSLELTI
FSEERNPLTPETLLTLEEMKIVSPDPGANLGKTDAANVEATVPPEGGSQNPEQSMTXXXX
XXXXXXXXXXXXDLFASTCVHGFRSFSGSLGTSDDHSASCQTCFPHKQQRQSVSPEPPPQ
CERHMKQLLLFCEEHRELVCLICLSQEHRGHQVRPIEEVALEYQDHINWQLEKLKELRKS
GEKQKCQGKKETDKFLKQTEDQKEKVRCQMQQLYRFLEKQEQHLVAWLEELGQMVSQVLV
QYNGRVSQDFALLDELISELEAKQCQPPWGLVQDIGVILQRANTMTVLELWATPPEVKEK
LHFFYHKSEAMEKSMKNILESLRSEMEAFTVQELKAAQAYAVDVILDAETAHPNLIFSDD
LKRVKLGNKWDQRPECPERFNSCIMALGSPTFFSGRHYWVEGDTGWILGVCKAAXXNDYR
ASAFPPINLLLKEPPRRVGIFLDYEAGDISFYNVITKSHIYTFTCSSSGPLQPVFSPGTH
DGGKNIDPLIIRQVCAQGRH
Download sequence
Identical sequences ENSPCAP00000003595 ENSPCAP00000003595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]