SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003864 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003864
Domain Number 1 Region: 688-883
Classification Level Classification E-value
Superfamily Sec7 domain 1.83e-76
Family Sec7 domain 0.00000156
Further Details:      
 
Domain Number 2 Region: 445-628,915-1057,1316-1491,1605-1624
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000173
Family Armadillo repeat 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003864   Gene: ENSPCAG00000003967   Transcript: ENSPCAT00000004119
Sequence length 1844
Comment pep:novel genescaffold:proCap1:GeneScaffold_1471:125701:229041:-1 gene:ENSPCAG00000003967 transcript:ENSPCAT00000004119 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYEGKKTKNMFLTRALEKILADKEVKAHHSQLRKACEVALXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLQEAKQMEKERHRQQHLLLQSPGSHHEP
ESPQLRYLPPQTVDHIAQEHEGDLDPHTNDVDKSLQDDTEPENGSDLSSAENEQTEADQA
TAAETLSKNDILYDGENQDLEEKPQDIVQSIVEEMVNIVVGXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESGNSSGPSPGAKFSHILQK
DAFLVFRSLCKLSMKPLSDGPPDPKSHELRSKILSLQLLLSILQNAGPVFRTNEMFINAI
KQYLCVALSKNGVSSVPEVFELSLSIFLTLLSNFKTHLKMQIEVFFKEIFLYILETSTSS
FDHKWMVIQTLTRICADAQSVVDIYVNYDCDLNAANIFERLVNDLSKIAQGRGSQELGMS
NVQELSLRKKGLECLVSILKCMVEWSKDQYVNPNSQTTLGQEKPPEQETSEIKHPETINR
YGSLNSLESTSSSGIGSYSTQMSGNDNPEQFEVLKQQKEIIEQGIDLFNKKPKRGIQYLQ
EQGMLGTTPEDIAQFLHQEERLDSTQVGEFLGDNDKFNKEVMYAYVDQHDFSGKDFVSAL
RMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTTDLHSP
QVKNKMTKEQYIKMNRGINDSKDLPEEYLSAIYNEIAGKKISMKETKELTIPTKSTKQNV
ASEKQRRLLYNLEMEQMAKTAKALMEAVSHVQAPFTSATHLEHVRPMFKLAWTPFLAAFS
VGLQDCDDTEVASLCLEGIRCAIRIACIFSIQLERDAYVQALARFTLLTVSSGITEMKQK
NIDTIKTLITVAHTDGNYLGNSWHEILKCISQLELAQLIGTGVKPRYISGTVRGREGSLT
GTKDQAPDEFVGLGLVGGNVDWKQIASIQESIGETSSQSVVVAVDRIFTRTTGLDGNAXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLVFEKHFPATIDSFQD
AVKCLSEFACNAAFPDTSMEAIRLIRHCAKYVSDRPQAFKEYTSDDMNVAPEDRVWVRGW
FPILFELSCIINRCKLDVRTRGLTVMFEIMKTYGHTYEKHWWQDLFRIVFRIFDNMKLPE
QQTEKAEWMTTTCNHALYAICDVFTQYLEVLSDVLLDDIFAQLYWCVQQDNEXXXXXXXX
XXXXVVILGKFTLEIWDKTCNCTLDIFKTTIPHALLTWRPTSGESAPLPPSPVSEKPLDT
ISQKSVDIHDSVQPRSADNRQQAPLALVSAVNEEVGKIKPTAKFPEQKLFAALLIKCVVQ
LELIQTIDNIVFFPATSKKEDAENLAAAQRDAVDFDVRVDTQDQGMYRFLTSQQLFKLLD
CLLESHRFAKAFNSNNEQRTALWKAGFKGKSKPNLLKQETSSLACGLRILFRMYTDEGRA
SAWEEVQHRLLNVCSEALSYFLTLTSESHREAWTNLLLLFLTKVLKISDNRFKAHASFYY
PLLCEIMQFDLIPELRAVLRRFFLRIGVVQISQPPEQELGANKQ
Download sequence
Identical sequences ENSPCAP00000003864 ENSPCAP00000003864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]