SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000003941 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000003941
Domain Number 1 Region: 237-385
Classification Level Classification E-value
Superfamily L domain-like 1.7e-28
Family Ngr ectodomain-like 0.0079
Further Details:      
 
Domain Number 2 Region: 406-589
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.59e-19
Family Rhodopsin-like 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000003941
Domain Number - Region: 110-161
Classification Level Classification E-value
Superfamily L domain-like 0.00408
Family Ngr ectodomain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000003941   Gene: ENSPCAG00000004164   Transcript: ENSPCAT00000004199
Sequence length 590
Comment pep:novel genescaffold:proCap1:GeneScaffold_3117:1960:48013:1 gene:ENSPCAG00000004164 transcript:ENSPCAT00000004199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLASQHLGGLSWTAMSLLLLFILLMDAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXDSSGWATIFGAVHGQAVNGAFAQECFLSQYPKLCDCKETELE
CINANLKSVPRVSSNVTLLSLKKNEIHHLPDKVFIKYTELKNXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSMVSN
RLEALPTQMCTPMPRLNWMDLEGNRIKALTNTTFLSCSSLTVLFLPSNQIDLVPEKTFAS
LYKLGELNLSNNLIRELPPHIFNDLKLLQKLNLSSNPLRHLHKNQFESLGQLQSLDLERI
EIPNISTRMFQHMKNLSHIYLKSFRYCAYAPVICVPLTDGISSFEDLLASHIMRIFVWVI
ASITCLGNLFVIGMRCLVKAENTTHAMSIKVLCCADCLMGVYLFSVGFFDLKYRGQYQKY
ASLWMDSLQCRLLGCLAVLSTEVSVLLLTYLTLEKFLVVVFPFRNVRPGRRQTAGILVGI
WVAGFIIAIVPLWNEDYFGNFYGKNGVCFPLYYEQTEDIGSKGYSLVIFL
Download sequence
Identical sequences ENSPCAP00000003941 ENSPCAP00000003941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]