SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000004219 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000004219
Domain Number 1 Region: 128-302
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-62
Family Protein kinases, catalytic subunit 0.0000000626
Further Details:      
 
Domain Number 2 Region: 2-110
Classification Level Classification E-value
Superfamily PH domain-like 8.4e-16
Family Pleckstrin-homology domain (PH domain) 0.0000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000004219   Gene: ENSPCAG00000004506   Transcript: ENSPCAT00000004499
Sequence length 463
Comment pep:novel genescaffold:proCap1:GeneScaffold_383:254913:375165:-1 gene:ENSPCAG00000004506 transcript:ENSPCAT00000004499 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQLMKTERPKPNTFIIRC
LQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDAS
TTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTE
SRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIV
SALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPE
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXDEDGMDCVDSERRPHFPQFSYSASGRE
Download sequence
Identical sequences ENSPCAP00000004219 ENSPCAP00000004219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]