SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006079 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006079
Domain Number 1 Region: 161-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.64e-26
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 77-133
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 123-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000155
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 47-90
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000387
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006079   Gene: ENSPCAG00000006564   Transcript: ENSPCAT00000006502
Sequence length 253
Comment pep:novel scaffold:proCap1:scaffold_84802:984:1745:1 gene:ENSPCAG00000006564 transcript:ENSPCAT00000006502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AETNIDNECTSTQGIHGERGMISCGLQKIVPQGTDLPETCEVEKHQKIPTVKSIRGKFER
IHSAEKPFRCHECGRCFSSFSYCVRHQRVHTGEKPYPCEECGKSFNESSSLIRHQRIHTG
EKPYQCEECGRAFNNSASLIRHQRIHSGDRPYLCKDCGNGFPSSSELVRHQRIHTGEKPY
KCNECGKAFTVKSTLSRHQRIHSGEKPYECTKCGETFRTSSQLCHHEHVYPGEKPILDLG
SFDLPAFFTPFSW
Download sequence
Identical sequences ENSPCAP00000006079 ENSPCAP00000006079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]