SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006405 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006405
Domain Number 1 Region: 404-709
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.19e-44
Family Rhodopsin-like 0.00087
Further Details:      
 
Domain Number 2 Region: 279-348
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000238
Family Ngr ectodomain-like 0.042
Further Details:      
 
Domain Number 3 Region: 26-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000903
Family LDL receptor-like module 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000006405
Domain Number - Region: 101-155
Classification Level Classification E-value
Superfamily L domain-like 0.00605
Family Ngr ectodomain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006405   Gene: ENSPCAG00000006823   Transcript: ENSPCAT00000006850
Sequence length 757
Comment pep:novel genescaffold:proCap1:GeneScaffold_5941:16873:123245:1 gene:ENSPCAG00000006823 transcript:ENSPCAT00000006850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGPIFFYILVIGKYFARGSGQDVTCSLGYFPCGNITKCLPQFLHCNGVDDCGNWADED
NCGDNNGWAMQLDKHFTNYYRMTSLNPFETETFECLVSSVPMKCICHGLELGCDETNLQA
IPSVSSNVTLMSLQSNLIRKLPSDGFKKYLDLQKLXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLMNNALTRLPDK
PLCQYMPRLLWLXXXXXXXXXXXXXXXXXXXXXXXXIMRENKINDLRENTFASLQKLDEL
DLGNNKIENLPPYVFKDLQDLSQLNLSYNPIQKIQENQFDYLVKLKSLXXXXXXXXXXXX
XXXXXXXXXXXXYFKKFQYCGYAPHVRSCKPNTDGISSVENLLASVIQRIFVWVVSAVTC
FGNIFVICMRPHIKSENKLHTMSIISLCCADCLMGIYLFVIGAFDLKFRGEYNKHAQLWM
ESIHCQFVGSLAILSTEVSVLLLTFLTLEKYICIVYPLRCLRPGKCRTITVLILIWTIGF
IVAFIPLSNKEFFKNYYGMNGVCFPLHSEDAESKGAHIYSVAIFLGVNLAAFIIIVFSYG
SMFYSVHRSAITTTEIRNQVNKEMMLAKRFFFIVFTDALCWIPIFILKFVSLLQVEIPGT
INSWVVIFILPINSALNPILYTLTTRPFKEMVHRVWHNYRQRRSINSKGSQKTYAPSFIW
VEMWPLQEIPSELMKPTLLTDPCETSLISSARPNSYS
Download sequence
Identical sequences ENSPCAP00000006405 ENSPCAP00000006405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]