SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000006747 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000006747
Domain Number 1 Region: 9-153
Classification Level Classification E-value
Superfamily L domain-like 6.63e-27
Family U2A'-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000006747   Gene: ENSPCAG00000007239   Transcript: ENSPCAT00000007210
Sequence length 263
Comment pep:novel genescaffold:proCap1:GeneScaffold_3898:7669:19104:-1 gene:ENSPCAG00000007239 transcript:ENSPCAT00000007210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMKKRINLELRNKAPEEVTELVLDNCRCVNGEIEGLNDTFKELESLSMADVELSSLARL
PSLNKLRKLELSNNSISGGLEVLAEKCPNLTYLNLSGNKIKDLSTVEALQNLKNLKSLDL
FNCEITNLEDYRESIFELLQQITYLDGFDQEDNEAPEASEEDDDDDEDDEDEEEDEAGPP
EGYEEDEEEEEEDDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQDEEDDDDYVEEGEE
EEEEEGLRGEKRKRDAEDDGEDD
Download sequence
Identical sequences ENSPCAP00000006747 ENSPCAP00000006747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]