SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000007354 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000007354
Domain Number 1 Region: 82-151
Classification Level Classification E-value
Superfamily L domain-like 0.000000000116
Family U2A'-like 0.0000469
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000007354   Gene: ENSPCAG00000007869   Transcript: ENSPCAT00000007857
Sequence length 254
Comment pep:novel genescaffold:proCap1:GeneScaffold_3043:54749:69637:-1 gene:ENSPCAG00000007869 transcript:ENSPCAT00000007857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKLTAELIEQAAQYTNAVRDRELDLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXRIGEGLDQSLPCLTELILTNNSLVELXXXDPLASLKSLYLSIL
RNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAEKMFKGKRGAQLAKDIARRSKTF
NPGAGLPTDKKKGGPSPGDVEAIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPADD
GEEEMEEDTVTNGS
Download sequence
Identical sequences ENSPCAP00000007354 ENSPCAP00000007354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]