SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009243 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009243
Domain Number 1 Region: 2130-2225
Classification Level Classification E-value
Superfamily Immunoglobulin 9.59e-21
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 2326-2418
Classification Level Classification E-value
Superfamily Immunoglobulin 8.64e-18
Family I set domains 0.031
Further Details:      
 
Domain Number 3 Region: 2514-2612
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-17
Family I set domains 0.019
Further Details:      
 
Domain Number 4 Region: 2422-2521
Classification Level Classification E-value
Superfamily Immunoglobulin 3.89e-17
Family I set domains 0.0084
Further Details:      
 
Domain Number 5 Region: 2239-2322
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000356
Family I set domains 0.027
Further Details:      
 
Domain Number 6 Region: 2036-2128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000125
Family I set domains 0.047
Further Details:      
 
Domain Number 7 Region: 1647-1685,1965-2016
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000143
Family I set domains 0.05
Further Details:      
 
Domain Number 8 Region: 27-108
Classification Level Classification E-value
Superfamily L domain-like 0.000000000000588
Family Ngr ectodomain-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009243   Gene: ENSPCAG00000009899   Transcript: ENSPCAT00000009904
Sequence length 2613
Comment pep:novel genescaffold:proCap1:GeneScaffold_4023:282582:309645:-1 gene:ENSPCAG00000009899 transcript:ENSPCAT00000009904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTGKGTTCWLVCLAAFCLLATPGGRACPRRCACYIPTEVHCTFRYLTSIPDGIPPHVE
RINLGYNSLARLTARDFSNLNKLELLMLHSNGIHTIPDKAFADLQALQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXV
IKCRRDRSPSGPQQCPLCMDPRTSKGKSFAMVPAAAFLCIKPTIDTSLKLQSLAVLEDSG
PAAVTPQDFMAPFGSFSLNMTDQSGNEATVVCSIQKPSRTSSIAFIEEKDSIKLNTSFST
HLVCNVDYSHIQPVWQVLALYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXRFREQRRVPPSARRMSQHWAELLEKAKNAPEKRENTTVQLTPPVP
QLRKLDEQEESSGVLPPGEEFLVWARTPLKVPGRTVSANPRTTYDSPVIDKITAGTEVSP
IVSPPEKPIDFNLYTTATATAKSMNANPTISIQMQDTANPNSSTIFPLLPGASERQNTDQ
KGRRRVHFLSMPAVTVGNPLSNINIKMFRDVSSKASVFLVSANTTDGHEPSGTAVSESRS
DHVYSQSPPKRSTSTLPTEPYTAANSQVKTPRNGASNAALFRRFGRHRKIGGRGRIISPY
RTPILGWRRYGFVRPRFQGSPEDSTPAFSAMAHSVTCPSCPPRERLVPTTALLSPPSSSS
VTRPQAAVTTATSEDSTSLLQNPSQLSDHKMNVQIEKTTPTIKYFHAENIQVTPTAAIRT
HTPTSTYMEKTHVMNTVPSIHEMKRDSWIISPLSDPISEPSMPTTTAITRFSRRKTPWNH
NFVNNYIQKERLRNLPKFGSQKSTARVLPKIPSALPTPKVFPDILPTVSESVMNIPSETL
ATNDHNTTETYSPRSLPVMKEQTFLPLHSTIASIASKESHTKISMPTAAPTASPAASASA
IISEIRTARPEPQKAQRLKGPQQPRDDPFISSGQISGFTTSMAMAPPVLATVEASTKSSG
SVFLHSLLESPKGISSDSGLHSRTLHRTDETEDLLQENTQTLNSTSAFETALPSSQHQSS
KTREAITRHTTVPPFLSSPATLMPMPTPPFIQSTVTDKISTPIFRTLANTVVQPSESSRH
DADLHQVAAAETTMSPKAHQNATLTIRTTPFVYPHELHSISMPVLSTAKLESSKLTPSPW
SENQFWPKSYPEIADKGKEPVGSKLSTLSLQEETTAASNWDAEKTAEKSIFEKAHIQKIS
TSEFLPFDSFSRTMFEKPRIVGGKAASFTVPANSDAFLPCEAIGNPLPAIHWTRVSSXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMG
SRIHVYPNGSLSIGSVTEKDGGVYLCVARNRMGDDVIRMHVGLRLKPARIDQKQQFKKQV
LHGKDFQVDCKASGSPVPEISWSLPDGTMINKAMQADDSGHRTRRYILFDNGTLYFNQVG
VAEEGDYTCYAQNTLGKDEMKVHLTVVTAAPQIKQTSKTYTRVKAGDTAILDCEVTGEPK
PRIFWLLPSNNMLSFSNSRYTFHDNGSLAISKVKLTDSGEYVCVARNPSGDDTQVYKLDV
VSKPPLINGLHANKTIMRVTAVRHSKKHFDCRAEGAPAPQVTWTMPDNIVLAAPYYGSRI
TVHENGTLEIRNMRLSDAADFICVARNEGGESVLVVRLQVLEMLRRPTFRNPFNEKVVAW
LGKSTALNCSVDGNPPPEIIWILPNGTRFSNGPRDSPFWIASNGSLIISKTAREDTGKYR
CAARNQVGYIEKLIVLEIGQKPVILTHALGMVKGVSGESLSLHCVSDGSPKPSIRWTLPN
GQVIDRPQTNGKYTLHENGTLVIKEAMVSNRGKYICEAQNSVGRALVTVPVVIVAYPPRI
TNRPPRSILTRTGTAVRLHCVALGVPEPEVMWEMPDHSVLSVASKRQPRGSELLQLPGTM
VIPNPQTSDSGIYKCVARNPLGRDYAATYIQVI
Download sequence
Identical sequences ENSPCAP00000009243 ENSPCAP00000009243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]