SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000009589 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000009589
Domain Number 1 Region: 67-341
Classification Level Classification E-value
Superfamily L domain-like 4.42e-48
Family Ngr ectodomain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000009589   Gene: ENSPCAG00000010347   Transcript: ENSPCAT00000010274
Sequence length 343
Comment pep:novel genescaffold:proCap1:GeneScaffold_5610:68115:70108:-1 gene:ENSPCAG00000010347 transcript:ENSPCAT00000010274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSQSREQNKSLGDLGPYASRTALLVLLLVASVPSSKTCLVSSSVNGSSITCHPPAEPPH
HLPADTIYLAVEFFNMTQLPVDALQGASNLQELHLSNNRLQNLSAEFLLPVPQLQVLDLT
HNALSHLPPGLFQASATLHTLSLKENHLEVLKPSWLSGLKALSYLDLSGNCLSTLPSGLM
ANLTALQTLNLGDNRLEVLPPDFLRGPRRLERLHLENNQLQVLGADLLSPQPGLRYLFVQ
NNSLATVAAGAFRGLQELDMLDLSDNLLSSVPTGLWASLGQPTRAMKEGFDLSGNPWVCD
ANLDDLCHWMVANNDTMFSRKNTLCAGPEAMKGRALLEVAGSR
Download sequence
Identical sequences ENSPCAP00000009589 ENSPCAP00000009589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]