SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010170 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010170
Domain Number 1 Region: 388-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.26e-38
Family Calponin-homology domain, CH-domain 0.0000935
Further Details:      
 
Domain Number 2 Region: 85-241,387-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.08e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.078
Further Details:      
 
Domain Number 3 Region: 991-1024
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000813
Family LIM domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000010170
Domain Number - Region: 1025-1054
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00314
Family LIM domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010170   Gene: ENSPCAG00000010795   Transcript: ENSPCAT00000010901
Sequence length 1122
Comment pep:novel genescaffold:proCap1:GeneScaffold_3161:49932:152418:1 gene:ENSPCAG00000010795 transcript:ENSPCAT00000010901 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEDEGEKQTQAGQIFQNFVQASTCKGTRQAFNILTRHLDLDPLDHRNFYSKLKSRVTTW
KAKALWHKLDKRGSHKEYKRGKSCMNTKCLIIGGGPCGLRTAIELAFLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPADHSLSEFEFDVIIGADGRRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDCVDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDFAMNH
YGQPDVAMFDFTCMYASENAALVRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWDQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSHCVR
PHQVKHLYITKELNSYPLEKVGSMRRSVGLSRQESDIRPSKLLTWCQQQTKGYQHVNVTD
LTTSWRSGLALCAIIHRFRPDLINFDSLNEDDAVKNNQLAFDVAEREFGVPPVITSKEMA
SAQEPDKLSIVMYLSKFYELFRGTPLRTVDSWGKFYGENADLSLAKSSLSNNYLNLTLPR
KRMPRVDVQTEENDLNKRRRKGFSNLDEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXEGRVSGIGKPVLCSSSASPVNPRCPKPKDPTPSPSPPLKRQL
PSVAVRGQVCREIKQVPAGGECSGRLWRARAKSDLQLGRLESPAAWPPTCQALALSGVLR
RLQEVEEKILQXXXXXXXXREFHQKNIKEKAALLASMFGHGDIPQNKLLSKGLFHGPAPP
SPPGSSPXXXXXXXXXXXXXXXXXXXVKKPLSGYPHPSHSRIVQPQXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXDCMRKVCPLNLGGSDTCYFCKKRVYVMERLSAEGHFFH
RECFRCSVCATTLRLAAYAFDCDEDKFYCKPHFFHCKTNNKQRKRRAELKQQKEEEEMWK
EQEAPHRDTPTESSCAAAVASGTPEGSPPVRFSLPVLHPLFG
Download sequence
Identical sequences ENSPCAP00000010170 ENSPCAP00000010170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]