SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010258 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010258
Domain Number 1 Region: 218-411
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.7e-41
Family SPRY domain 0.00022
Further Details:      
 
Domain Number 2 Region: 77-146
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000167
Family RING finger domain, C3HC4 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010258   Gene: ENSPCAG00000011019   Transcript: ENSPCAT00000010992
Sequence length 414
Comment pep:novel scaffold:proCap1:scaffold_7703:33510:38557:-1 gene:ENSPCAG00000011019 transcript:ENSPCAT00000010992 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWGDQRPRQTSEAVLGEVQKAQKVNAGYRERVPASANSKARTPSVPSKAATVVAREVAP
RPALPMEAPELGPGLVERLEQLATCPLCGGHFKDPVLLACEHSFCRACLARCWGPPPAAG
TEATPTACPCCGQPCPRRSLRSNVRLAVEVRISRGXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXDMRKTWSRFDVPIPKSPNSEDNLPEDYPVVKNMLHRLAAELTLDPGTAHRHLIV
SSDCRSVRLAPLRSPALDSPARFDQLPAVLGAQGFHAGRHCWEVETMHTASCGDSSGEDE
DDGESRYAVGAAGESVQRKGRVGLCPAEAVWAVEGRGGRLWALTAPEPTPLSRPLPRRIR
VDLDWERGRVAFYDGRSLDLLFAFQAPGPLGERVFPLLCTCDPRVPLRIVPAEG
Download sequence
Identical sequences ENSPCAP00000010258 ENSPCAP00000010258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]