SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013357 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013357
Domain Number 1 Region: 851-932
Classification Level Classification E-value
Superfamily DEATH domain 9.89e-22
Family DEATH domain, DD 0.00000838
Further Details:      
 
Domain Number 2 Region: 155-246
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000022
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 245-296
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000157
Family TSP-1 type 1 repeat 0.00061
Further Details:      
 
Domain Number 4 Region: 298-353
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000536
Family TSP-1 type 1 repeat 0.00059
Further Details:      
 
Domain Number 5 Region: 48-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000318
Family I set domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013357   Gene: ENSPCAG00000014252   Transcript: ENSPCAT00000014297
Sequence length 941
Comment pep:novel genescaffold:proCap1:GeneScaffold_1697:4880:98387:1 gene:ENSPCAG00000014252 transcript:ENSPCAT00000014297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWALSGARGALLLALLFCWHPKLSQAGTDSGSEVLPDSFPSAPAEPLPHFLQEPQDAYIV
KNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQESLDEATGLRVREVQIEVSRQRVEEL
FGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGV
PVAEVEWLKNEDIIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTAT
VIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCDGQAFQKTACTTVCP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQSGGRDCSGTLLDSKNCTDGLCMQNKKTL
SDPKSHLLESSGDVALYAGLVVSIFVVVVVLMVVGVVVYRRSCRDFDTDITDSSAALTGG
FHPVNFKTARPNNPQLLHPSVPPDLTAGASIYRGPVCALQDSADKIPMTNSPLLDPLPSL
KIKVYSSSTTGSGPGLPDGADLLGVLPPGTYPGDFTRDAHFLHLRSASLSSQQLLGLPRD
PGSSISGTFGCLGGRLSIPGTGVSLLVPNGAPQGKFYEMLLINKADNTLPLSEGTQTVLS
PSVTCGPTGLLLCRPVILTVPHCAEVSAGNWIFQLKTQAHQHWEEVVTDEETLNTPCYCQ
LEARSCHILLDQLGTYVFAGESYSRSAVKRLQLAIFAPALCTSLEYSLRVYCLEDTPVAL
KEVLELERTLGGYLVEEAKPLLFKDSYHNLRLSLHDIPHDHWRSKLLAKYQEIPFYHIWS
GSQKALHCTFTLERLSLAFTELTCKICVRQVEGEGQIFQLHTTLAETAAGSLDALCSAPT
GATNTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKASPTG
VILDLWEALQQDDGDLNSLASALEEMGKSEMLVAMATDGDC
Download sequence
Identical sequences ENSPCAP00000013357 ENSPCAP00000013357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]