SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015303 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015303
Domain Number 1 Region: 6-149
Classification Level Classification E-value
Superfamily L domain-like 3.74e-29
Family U2A'-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015303   Gene: ENSPCAG00000016369   Transcript: ENSPCAT00000016348
Sequence length 250
Comment pep:novel genescaffold:proCap1:GeneScaffold_3426:3612:27137:1 gene:ENSPCAG00000016369 transcript:ENSPCAT00000016348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPK
LPKLKKLELSDNRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDLFN
CEVTNLNDYRESVFKLLPQLTYLDGYDQEDREAPDSDAEVDGVDEEEEDEEGEEEEDDEE
EDGEEDFDEEDEEDEDEDVEGEEDEDEVSGEEEDFGPDEEDEDEDEDEEEEESGKGEKRK
RETDDEGEDD
Download sequence
Identical sequences ENSPCAP00000015303 ENSPCAP00000015303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]