SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015469 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015469
Domain Number 1 Region: 241-418
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00000125
Further Details:      
 
Domain Number 2 Region: 37-129
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.46e-16
Family BAR domain 0.022
Further Details:      
 
Domain Number 3 Region: 563-618
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000512
Family SH3-domain 0.00017
Further Details:      
 
Domain Number 4 Region: 101-187
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000167
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015469   Gene: ENSPCAG00000016479   Transcript: ENSPCAT00000016528
Sequence length 619
Comment pep:novel genescaffold:proCap1:GeneScaffold_5445:1696:88391:1 gene:ENSPCAG00000016479 transcript:ENSPCAT00000016528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADTQIDREHQNFXXXXXXXXXXXXXXXXXXXXXXXXXLLSFLQGLFTFYHEGYELAQEFA
PYKQQLQFNLQNTRNNFESTRQEVERLMQRMKSANQDYRPPSQWTMEGYLYVQEKPLGPL
GFTWIKHYCTYDKGSKTFTMSVSEMKSSGKVNGLVTSSPEMFKLKSCIRRKTDSIDKRFC
FDIEVVEXXXXXXXXXXXXXXXXXXXXXXXXXXXIYTLPAIISKKEESKLLLYLNEAGFN
FVRKCIQAVETRGITILGLYRIGGVNSKVQKLMNTTFSPKSPPDIDIDIELWDNKTITSG
LKNYLRCLAEPLMTYKLHKDFILAVKSDDQNYRVEAVHALVHKLPEKNREMLDILIKHLV
KVSLHSQQNLMTISNLGVIFGPTLMRAQEETVAAMMNIKFQNIVVEILIEHYEKIFHTAP
DPSIPLPQPQSRSGSRRTRAICLSTGSRKPRGRYTPCLAEPDSDSYSSSPDSTPMGSIES
LSSHSSERNSTPKSTSCQPREKSGGIPWIATPSPANGQKSLGXXXXXXXXXSKEMPKAPS
NPDLPPKMCRRLRLDTTSSNGSFSQAKAMYSCKAEHSHELSFPQGAIFSNVYPSVEPGWL
KATYEGKTGLVPENYVVFL
Download sequence
Identical sequences ENSPCAP00000015469 ENSPCAP00000015469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]