SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015672 from Procavia capensis 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015672
Domain Number 1 Region: 286-351
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000395
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 2 Region: 79-102
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000759
Family CCCH zinc finger 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000015672
Domain Number - Region: 376-407
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000667
Family CCCH zinc finger 0.0038
Further Details:      
 
Domain Number - Region: 222-244
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00123
Family CCCH zinc finger 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015672   Gene: ENSPCAG00000016788   Transcript: ENSPCAT00000016746
Sequence length 482
Comment pep:novel scaffold:proCap1:scaffold_36188:16407:17855:-1 gene:ENSPCAG00000016788 transcript:ENSPCAT00000016746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETAAPSEAYEASGAEASAGAAEESGRKPGLPAPEASRELAARSPAPTRASGLRPAQGA
GGGARPLPLPGRSSGSWTKLVTCRYYLHGLCKEGENCRYSHDLSGRPPATVGPDAALRAY
ADSRGDAAAQIRARAPEVAGTSRGTSSLSLPLIGSAAEGRFFGEEADNGGGVAAGASSAS
WADAVEFVPGQPYRGRWALYAPETSPQSSLTETEHSAVGAGEPLCPYAAVGECPDGERCV
YLHGEACDMCGLQILHPVDAAQRAEHIKSCIEAHERDMELSFAVQCSMDKVCGICMEVVY
EKANPNDRRFGVLSNCNHTYCLKCIREWRRARQFENRVVKSCPQCRVPSDLVIPSEFWVE
EEEKKQTLIQQYKEAMSNKPCRYFAEGRGHCRFGEHCFYKHAYPESQEPPQRQDAGTFST
YWSKFVEVSMPFKGHEKGLVRLHLSKLLFRRLLLKGYEKFPFSEDLWELLLFELEKYLNL
IL
Download sequence
Identical sequences ENSPCAP00000015672 ENSPCAP00000015672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]