SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000088 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000088
Domain Number 1 Region: 159-227
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.11e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0023
Further Details:      
 
Domain Number 2 Region: 70-137
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000013
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 3 Region: 515-564
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000123
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000088   Gene: ENSPVAG00000000093   Transcript: ENSPVAT00000000093
Sequence length 569
Comment pep:novel scaffold:pteVam1:scaffold_4352:1424:3961:1 gene:ENSPVAG00000000093 transcript:ENSPVAT00000000093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSLFADLERNGSGGGGGGGGGGGGETLDDQRALQLALDQLSLLGLDSDEGASLYDSEP
RKKSVNMTECVPVPSSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKED
VAMARREIISAAEHFSMIRASRNKNTALNGAVPGPPNLPGQTTIQVRVPYRVVGLVVGPK
GATIKRIQQQTHTYIVTPSRDKEPVFEVTGMPENVDRAREEIEAHIALRTGGIIELTDEN
DFHANGTDVGFDLHHGSGGSGPGSLWSKPTPSITPTPGRKPFSSYRNDSSSSLGSASTDS
YFGGGTGGSAAATPRLADYSPPSPALSFAHNGNNNNNGNGFTYSAGEASVPSPDVCPELQ
PTFDPAPAPPPGAPLLWAQFERSPGGGPAAPASSSCSSSASSSASSSSVVFPGGGASAPS
NANLGLLVHRRLHPGASCPRLSPPLHMAPGTGEHHLARRVRSDPGGGGLAYAAYANGLGA
QLPGLQPSDTSGSSSSSSSSSSSSSSSSGLRRKGSRDCSVCFESEVIAALVPCGHNLFCM
ECANRICEKSEPECPVCHTAVTQAIRIFS
Download sequence
Identical sequences ENSPVAP00000000088 XP_011374397.1.92234 ENSPVAP00000000088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]