SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000105 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000105
Domain Number 1 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.48e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 503-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000006
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 438-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000229
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000000105
Domain Number - Region: 23-54
Classification Level Classification E-value
Superfamily POZ domain 0.00612
Family BTB/POZ domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000105   Gene: ENSPVAG00000000111   Transcript: ENSPVAT00000000111
Sequence length 615
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3743:55127:59156:1 gene:ENSPVAG00000000111 transcript:ENSPVAT00000000111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSGPLALRWYAWAGRGDMGPDMELPSHSKQLLLQLNQQRTKGFLCDVIIMVEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGMGRPPRNQRLTASVIQARYPWLMDG
RKGAHTPQELPQAKGSDDELFLGGSNQESVHGLVRAVCPASGEAGLGSCSTNGSSGGCEQ
ELGLDLSKKSPPLPPATPGPPLTPDDPAQLSDSQHGSPLSASAPPIANSASYAELGGTPS
EPMDLEGAEDNHLSLLEGPGGQPRKSLRHSARKKEWSKKEPMAGSPFERREAGPKGPCPG
EESEGLGDRVPNGILANSVAGGGPSGPYGDPPFPCKEEEENGKDGSEDSGQSGSEGGSGH
TSAHYMYRQEGYETVSYGDNLYVCIPCAKGFPSSEQLNAHVETHTEEELFIKEEGAYETG
SGGAEEEAEDLSAPSTAYAAEPRPFKCSVCEKTYKDPATLRQHEKTHWLTRPFPCNICGK
MFTQRGTMTRHMRSHLGLKPFACDECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQ
QRNLISHLRMHTSPS
Download sequence
Identical sequences ENSPVAP00000000105 ENSPVAP00000000105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]