SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000304 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000304
Domain Number 1 Region: 46-495
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.22e-93
Family Integrin alpha N-terminal domain 0.000000000354
Further Details:      
 
Domain Number 2 Region: 495-651
Classification Level Classification E-value
Superfamily Integrin domains 1.2e-43
Family Integrin domains 0.0000103
Further Details:      
 
Domain Number 3 Region: 837-1008
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-29
Family Integrin domains 0.0013
Further Details:      
 
Domain Number 4 Region: 652-747
Classification Level Classification E-value
Superfamily Integrin domains 3.4e-25
Family Integrin domains 0.0000923
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000304   Gene: ENSPVAG00000000330   Transcript: ENSPVAT00000000330
Sequence length 1055
Comment pep:novel genescaffold:pteVam1:GeneScaffold_548:155656:176537:-1 gene:ENSPVAG00000000330 transcript:ENSPVAT00000000330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRALRSPLHSVQPRWGPRRRHPLLPLLLPLLLLLLPPPPRVGGFNLDAEAPTVLSGPP
GSFFGFSVEFYRPGTNGVSVLVGAPKANTSQPGVLQGGAVYLCPWGTSLAQCTPIEFDSK
GSRILESSLSIPEGEEPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTC
YLSTDNFTRILEYAPCRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSA
TQEQIAESYYPEYLINLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKG
NLTYGYVTILNGSDIRSLYNFSGEQMASYFGYAVAVSDINGDGLDDLLVGAPLLMERTAD
GRPQEVGRVYVYLQQPTGMEPTPTLTLTGHDEFGRFGSSLTPLGDLDRDGYSDVAIGAPF
GGETQQGVVFVFPGGIGGLGSKPSQVLLPLWAAGHTPHFFGSALRGGRDLDGNGYPDLIV
GSFGVDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHV
PDSIGFTVELQLDWQKQKGGIRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESE
FRDKLSPIHIALNFSLDPQAPVDSHGLQPVLHYQSKSRIEDKAQILLDCGEDNICVPDLQ
LEVFGEQNHVYLGDKNSLNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSL
SCDYFAVNQSRLLVCDLGNPMKAGASXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINLG
PASISRGALELSCPKTLKGQQLLYMTKFTGLSNCTARHLPNSEHLELDPEGSQNHRLQRR
EAPGQSPASSWPQILKCPEVECFRLRCELGPLHRQESRSLQLHFRVGAKTFLQREHQPFS
LQCEAVYEALKMPYRILPRQLPRKELQVATAVQWTKAEGSHGVPLWIIILAILIGLLLLG
LLIYILYKLGFFKRSLPYGTAMEKAQLKPPATSDA
Download sequence
Identical sequences ENSPVAP00000000304 ENSPVAP00000000304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]