SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000581 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000581
Domain Number 1 Region: 10-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.58e-23
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 2 Region: 377-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.91e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 265-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.91e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 476-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.65e-17
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 226-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.4e-17
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 6 Region: 306-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.61e-16
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 7 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000905
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000000581
Domain Number - Region: 357-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00382
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000581   Gene: ENSPVAG00000000617   Transcript: ENSPVAT00000000617
Sequence length 540
Comment pep:novel scaffold:pteVam1:scaffold_3817:19837:51126:1 gene:ENSPVAG00000000617 transcript:ENSPVAT00000000617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTPGLLTTRDQALMAFQDIAVAFTEKEWKILSPAQRTLYRDVMLENYSHLVSLGIAFSKP
ELITQLEQGDEPWKDESECLLDLCPEPRTEFQPCLSWPVAFSSPQFLRQYVLCGHPPQIF
PSSSAGNYFPLEAPSCSSEKAEDGERKGSNAMFKRPSRISSVFFSPFQGQPVDTVVGSRG
GGINQGMASKEETVLMKKNISESGAVTYGKYRLGLSTNPSLFSVQKHHVCPECGRGFCQR
SDLLKHQRMHTGEKPYSCRECGRGFGRKSSLTIHQRKHSGEKPYVCRECGRHFRYTSSLT
NHKRIHSGERPFVCQECGRGFRQKIALLSHQVTHSGEKPYICADCGHGFRQKVTLFHRSS
HSGERPFLCLECACDFRQSLLLSHQRTHTGEKPYVCPECGRGFGQKVTLIRHQRTHTGEK
PYLCSECGRTFGFKSLLTRHQRTHSGKEAEVYRVCEQGLSQKSQLTSDQRTHPEEKPCVC
DECGRGFGFKSALIRHQRTHSGEKPYVCKECGRGFSQKSHLHRHKRTKSGHHPLPQGLLS
Download sequence
Identical sequences ENSPVAP00000000581 ENSPVAP00000000581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]