SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000862 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000862
Domain Number 1 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.1e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 175-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.69e-24
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.1e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 441-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 7 Region: 137-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-20
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000862   Gene: ENSPVAG00000000910   Transcript: ENSPVAT00000000910
Sequence length 500
Comment pep:novel scaffold:pteVam1:scaffold_12996:5658:7160:-1 gene:ENSPVAG00000000910 transcript:ENSPVAT00000000910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTENKEVIPKEEVSEESELHGAILEQLPKVVYQGHELGAACEEDILEGHSRESTEEIME
QMSPQKRDFASGLIIFKKSPSSEKDQESERVCSSSPNLIAHQEDITAEVVSTFATSGQNF
IGNLEPNQTQRSSMGEKPHTCKECGKAFNQNSHLIQHMRVHSGEKPFECKECGKTFGTNS
SLRRHLRIHAGEKPFACNECGKAFIQSSHLIHHHRIHTGERPYKCEECGKAFSQNSALIL
HQRIHTGEKPYECNECGKTFRVSSQLIQHQRIHTEERYHECSECGKAFKHSSGLIRHQKI
HTGEKPYLCNECGKGFGQSSELIRHQRIHTGDKPYECNECGKTFGQNSEIIRHIRIHTGE
KPYVCKECGKAFRGNSELLRHERIHTGEKPYECFECGKAFRRTSHLIVHQRIHTGEKPHQ
CNECARTFWDNSELLLHQKIHIGEKPYECNECEKTFSQHSQLIIHQRIHTGEKPYECQEC
QKTFSRSSHLLRHQNVHCME
Download sequence
Identical sequences ENSPVAP00000000862 ENSPVAP00000000862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]