SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001421 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001421
Domain Number 1 Region: 161-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000254
Further Details:      
 
Domain Number 2 Region: 72-157
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000326
Further Details:      
 
Domain Number 3 Region: 351-426
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.14e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000694
Further Details:      
 
Domain Number 4 Region: 251-325
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000107
Family Eukaryotic type KH-domain (KH-domain type I) 0.000044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001421   Gene: ENSPVAG00000001510   Transcript: ENSPVAT00000001509
Sequence length 572
Comment pep:novel genescaffold:pteVam1:GeneScaffold_823:5948:53532:1 gene:ENSPVAG00000001510 transcript:ENSPVAT00000001509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQKRPL
DDGVGNQLGALVHQRAVITEEFKVPDKMVGFIIGRGGEQISRIQAESGCKIQIASESSGI
PERPCVLTGTPESIEQAKRLLGQIVDRCRNGPGFHNDIDGNSTVQEILIPASKVGLVIGK
GGETIKQLQERTGVKMVMIQDGPLPTGADKPLRITGDPFKVQQAREMVLEIIREKDQADF
RGIRSDFTSRMGGGSIEVSVPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGISPERA
AQVMGPPDRCQHAAHIINELILTAQERDGFGGLAVARGRGRGRGDWSMGTPGGIQEITYT
VPADKCGLVIGKGGENIKSINQQSGAHVELQRNPPPNTDPSLRVFTIRGVPQQIEVARHL
IDEKVGGAGLGAPGAFGQSPFSQPPAAPHQTTFPPRSSGCFPNMAAKVNGNPHSAPVSGP
PAFLAQGWGSTYQAWQQPTQQVPGQQSQPQSSQSDYSKAWEDYYRKQSHAASAAPQASSP
PDYTMAWAEYYRQQVAFYGQTLGQAQAHSQEQ
Download sequence
Identical sequences ENSPVAP00000001421 ENSPVAP00000001421 XP_011368342.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]