SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000001652 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000001652
Domain Number 1 Region: 13-70,98-158
Classification Level Classification E-value
Superfamily POZ domain 1.29e-27
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 354-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000106
Family Classic zinc finger, C2H2 0.00082
Further Details:      
 
Domain Number 3 Region: 392-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000238
Family Classic zinc finger, C2H2 0.00068
Further Details:      
 
Domain Number 4 Region: 465-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000382
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Domain Number 5 Region: 594-629
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000643
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000001652
Domain Number - Region: 291-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00196
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000001652   Gene: ENSPVAG00000001749   Transcript: ENSPVAT00000001749
Sequence length 687
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3465:225743:242819:-1 gene:ENSPVAG00000001749 transcript:ENSPVAT00000001749 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDESFPAHRAVLA
ACSEYFESVFSAQLGDGGAADGGPADVGGATAAPGGGAGGSRELEMHTISSKVFGDILDF
AYTSRIVVRLESFPELMTAAKFLLMRSVIEICQEVIKQSNVQILVPPARADIMLFRPPGT
SDLGFPLDMTNGAALAANSNGIAGSMQPEEEAARAAGAAIASQASLPVLPGVDRLPMVAG
PLSPQLLTSPFPNVASSAPPLTGKRGRGRPRKANLLDSMFGSPGGLREAGILPCGLCGKV
FTDANRLRQHEAQHGVTSLQLGYIDLPPPRLGENGLPISEDPDGPRKRSRTRKQVACEIC
GKIFRDVYHLNRHKLSHSGEKPYSCPVCGLRFKRKDRMSYHVRSHDGSVGKPYICQSCGK
GFSRPDHLNGHIKQVHTSERPHKCQTCNASFATRDRLRSHLACHEDKVPCQVCGKYLRAA
YMADHLKKHSEGPSNFCSICNRGFSSASYLKVHVKTHHGVPLPQVSRHQEPIPNGGAAFH
CARTYGNKEGQKCSHQDPIESSDSYGDLSDASDLKTPEKQSTNGSFSCDMAVPKNKMESD
GEKKYPCPECGSFFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLESFG
FQIVQSAFASSLVDPEVDQQPMGPEGK
Download sequence
Identical sequences ENSPVAP00000001652 ENSPVAP00000001652 XP_011382578.1.92234 XP_016020871.1.101085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]