SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000002038 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000002038
Domain Number 1 Region: 24-151
Classification Level Classification E-value
Superfamily POZ domain 2.24e-26
Family BTB/POZ domain 0.0013
Further Details:      
 
Domain Number 2 Region: 544-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.42e-20
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 505-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000605
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 4 Region: 433-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000896
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000002038   Gene: ENSPVAG00000002158   Transcript: ENSPVAT00000002158
Sequence length 733
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2866:293548:296074:1 gene:ENSPVAG00000002158 transcript:ENSPVAT00000002158 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFPEADIFLKSGDCAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRA
HKNVLAASSAYLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLADGAEAAAAAAVAP
GTEPSLGAVLAAASYLQIPDLVALCKKRLKRHGKYCHLRGGGGGGGGYAPYGRPGRGLRA
TTPVIQACYSSPAGPPPPPSAEPPSGPEASVNTHCAELYASGPGPASALCAAERRCSPLC
GLDLSKKSPPGSAPPERPPGERELPPRPDSPPSAGPAAYKEPPLSLPPLPPLPFQKLEEA
VPPPDPFRGGGGSPGPEPPGRPDGPSLLYRWMKHEPGLGTYGDELGRDRSSPGERCEERG
GDPAASPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYP
CPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLNAHVEAHVEEEEALYGRAEAAEVAAGAA
GLGPPFGAGGDKVPGAPGGLGELLRPYRCASCDKSYKDPATLRQHEKTHWLTRPYPCTIC
GKKFTQRGTMTRHMRSHLGLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKF
AQQRNLISHMKMHAVGGAAGAAGALAGLGALPGVPGPDGKGKLDFPEGVFAVARLTAEQL
SLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAA
GPDGRTIDRFSPT
Download sequence
Identical sequences ENSPVAP00000002038 ENSPVAP00000002038 XP_011358162.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]