SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004476 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPVAP00000004476
Domain Number - Region: 185-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000655
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004476   Gene: ENSPVAG00000004728   Transcript: ENSPVAT00000004729
Sequence length 864
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1590:61698:108897:-1 gene:ENSPVAG00000004728 transcript:ENSPVAT00000004729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPAEVADLLPSMPFQKQVYYSLGSGLEGPDGPAAAAAGAAAMACVPPSAASGHLPFFQFR
PRLESVDWRRLSAIDVDKVAGAVDVLTLQENIVNITFCKLEDEKCPHCQSGVDPVLLKLI
RLAQLTIEYLLHSQEFLTSQLHNLEERLRLSLADCEQSKNLLTKQAGEIKLLKEECKRRK
KMISTQQMMIEAKASYYQCHFCDKAFMNQAFLQSHIQRRHPEDSHFEYKKKAQTDKLQSE
IDMLKEQLQLTKSQLEAAQHAHAVRFSKEYEMQKTKEEEFLKLFDRWKEEEKEKLVDEME
KVKEMFMKEFKELTSKNTALEYQLLEIQKSNMQIKSNIGTLKDEHEFKEERPQYPQDFQN
VMQLLDSQESKWTARVQALHQEHKKEKGRLLSHIEKLRTSMIDDLNASNVFYKKRIEELG
QRLQEQNELIITQRQQIKEFTSKPFNSVIEPKGNSLTWQTFESKPTAPAIPMNVPAPQTL
DAKSSLTVAHEQAFSSHILEPIEELSEEEKGRENEQKLNNNKNHLRKALKNNPSLTKEIR
TVLEQSLVEKLETLGINADIRGIPSDHLNRVLKTVESARHDRERQIPNIQQIREYLEHEV
SCKIEERTLXXXXKYSAAQMDTLSTGEIPKAIHLPPKSRQLIRQRPVFTDRTSVPKIKKN
IIEDNFPRKSSTIMTSPFSSEEELDGDDLIQAYTSPDLPPAQSSKSKSSFGKNNVKSDTD
WTEGSEIEDSDISPKPTGTSIKTLTEKVEKTVSNHRNVNKPVGGINVAEAFTRRELKEEL
KYADVDDDDWDISSLEEEKSLGKKTGKEQKEPPPVKNESNATQVPSAWGAPNLKGPKGEG
LQDESSTLKSSLVTVTDWSDSSDV
Download sequence
Identical sequences ENSPVAP00000004476 ENSPVAP00000004476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]