SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000004953 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000004953
Domain Number 1 Region: 332-424
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.14e-24
Family Tudor domain 0.00000355
Further Details:      
 
Domain Number 2 Region: 122-203
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000757
Further Details:      
 
Domain Number 3 Region: 50-122
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000152
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000004953   Gene: ENSPVAG00000005234   Transcript: ENSPVAT00000005234
Sequence length 561
Comment pep:novel scaffold:pteVam1:scaffold_20502:8171:14074:-1 gene:ENSPVAG00000005234 transcript:ENSPVAT00000005234 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTERTSWTTLSTVQKIALGLGIPASAAVAYILYRRYRESREERLTFVGEDDVEMEMRVP
QEAVKLIIGRQGANIKQXXXXXXXXXXVDTEDVGDERVLLISGFPVQVCKAKAAIHQILT
ENTPVSEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQ
KEVAAAKHLILEKVSEDEELRKRIAHSAETRVPRKQPISVRREAMAEPGAAGEPALWQSA
GARTQQASPPGAPPHRGGGDVAIVGPEEGSWETPNSDSVQKSGAQTSPETSMFEIPSPDF
SFHADEFLEVYVSASEHPNHFWIQIIGSRSLQLDKLVSEMTQHYENSLPEDLTVHVGDIV
AAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLRDLRALRSDFLSLPFQAVECS
LARIGPAGEQWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKIYLYDTSSGEKL
DIGLELVRKGYAVELPEDMEENRAVSDTLHDAATETDISVSSVLTETRKSPEERANTLSC
LSLSEAASMSGDDNLEDDFLI
Download sequence
Identical sequences ENSPVAP00000004953 ENSPVAP00000004953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]