SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005095 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005095
Domain Number 1 Region: 49-173
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 5.06e-33
Family Ribonuclease PH domain 1-like 0.00017
Further Details:      
 
Domain Number 2 Region: 267-368
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.33e-22
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00000856
Further Details:      
 
Domain Number 3 Region: 190-273
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 2.49e-19
Family Ribonuclease PH domain 2-like 0.0041
Further Details:      
 
Domain Number 4 Region: 343-428
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000000108
Family Ribonuclease PH domain 1-like 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000005095
Domain Number - Region: 593-635
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000594
Family Eukaryotic type KH-domain (KH-domain type I) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005095   Gene: ENSPVAG00000005379   Transcript: ENSPVAT00000005380
Sequence length 784
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2599:262205:305087:-1 gene:ENSPVAG00000005379 transcript:ENSPVAT00000005380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAACRHCCSCLRLRPLGDSPLRLPGRDRALTQLQVRTLWGGAGSRAVAVDLGSRKLEISS
GKLARFADGSAVVQSGDTAVMVTAVSKTKPSPSQFMPLVVDYRQKAAAAGRIPTNYLRRE
IGSSDKEILTSRVIDRSIRPLFPAGYFYDTQVLCNLLAVDGVNEPDVLAINGXXXXXXXX
XXXXXXXXXAVRIGMIDGECVVNPTRKEMSSSTLNLVVAGAPKSQIVMLEASAENILQQD
FCHAIKVGVKYTQQIIQGIQQLVKEIGVTKRTPQKLFIPSSEIVKHTHKLAMERLYAVFT
NYEHDKISRDEAVNKIRLDTEEQLKEKFPEVESYEIIESFNVVAKEVFRSIILNEYKRCD
GRDLTSLRNINCEVDMLKILHGSALFQRGQTQVFCTVTFDSLESSIKSDRIITAINGIKD
KNFMLHYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XSSSMASACCGSLALMDAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAKKEILQIMNKTISKPRTSR
KESGPVVETVQVPLSKRAKFVGPGGYYLKKLQAETXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDTGVMVKLYPTMTAVLLHNSQLDQRKXXXX
XXXXXXXXXXXXVKYFGRDPADGRMRLSRKVLQSPATTVVKTLNDRSSIVMGETFSQSSS
NSSQ
Download sequence
Identical sequences ENSPVAP00000005095 ENSPVAP00000005095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]