SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005317 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005317
Domain Number 1 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.01e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 235-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-20
Family KRAB domain (Kruppel-associated box) 0.00055
Further Details:      
 
Domain Number 4 Region: 431-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.53e-20
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 5 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.73e-20
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 6 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-19
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 487-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 139-192
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000513
Family Classic zinc finger, C2H2 0.0081
Further Details:      
 
Domain Number 9 Region: 338-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000624
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000005317
Domain Number - Region: 111-144
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000356
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005317   Gene: ENSPVAG00000005621   Transcript: ENSPVAT00000005620
Sequence length 543
Comment pep:novel scaffold:pteVam1:scaffold_32708:1036:3262:1 gene:ENSPVAG00000005621 transcript:ENSPVAT00000005620 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSVAFEDVAVNFTPEEWALLDPSQKKLYRDVMRETFENLASVGKRMEDYDIEDQYKNQER
KLRSHIEERICESDASGQCEENLSLISNLSLNKKRTFPRVKPWEHSVRREVFIQHSSCNR
HIRYHTGYHPYEYQKHGEKPYKCKASVRALSYLQSSEKHERNHNGGEKPFECKQCTKAFS
HLSYLQRHERTHTGEKPYECKQCTKAFSCLSSLRRHQRTHTGEKPYECKQCGKFYRDHFY
LQIHKRIHTEEKPYKCKQCTKAFRYLSNLRSHEKLHTGGKPYECKQCGKAFRESHFLKTH
ERTHTGEKPYECKQCSKAFSCPGSLRKHKKIHTEQKLYKCKECGKAYRDYRKLQTHERTH
TGEKPYACKQCTKAFSRLSHLQRHERTHTVETLCKCKECGKAYRDYSKLQTHKRTHTGEK
PYECKQCGKFYRDHSYLQKHKRIHNEEKPYKCMQCSKAFSCPSSLLKHKRVHTGVKPYAC
KQCGKPFRESHSLNTHERTHTGEKPYKCKLCTKAFSCPSSLSKHKIMHTEQKLYKCKECG
KAY
Download sequence
Identical sequences ENSPVAP00000005317 ENSPVAP00000005317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]