SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005532 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005532
Domain Number 1 Region: 383-594
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.12e-75
Family Eukaryotic proteases 0.00000355
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000005532
Domain Number - Region: 124-158
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000216
Family Pan module (APPLE domain) 0.086
Further Details:      
 
Domain Number - Region: 299-341
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00451
Family Pan module (APPLE domain) 0.026
Further Details:      
 
Domain Number - Region: 220-262
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00471
Family Pan module (APPLE domain) 0.066
Further Details:      
 
Domain Number - Region: 40-63
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0255
Family Pan module (APPLE domain) 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005532   Gene: ENSPVAG00000005847   Transcript: ENSPVAT00000005848
Sequence length 631
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2711:143657:164701:1 gene:ENSPVAG00000005847 transcript:ENSPVAT00000005848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISFRQAAYFICLFATVSCECRTRLYKNTFFRGGDVTAMYTPNAQHCQKMCTFHPRCLLF
SFLPVGSTNDTDKRFGCFLKDSTTGILPRVSRTSAISGHSLKQCGHRISACQRDIYEAID
MRGVNFNVSRVKSVEECQKRCTNSIHCKFFTYAMQTFHNSEYRNSCILKHSPTGTPTSIK
VLENVASGFSLKPCALSEIGCHMNMFQHLKFSDVDVARVTAPDAFVCRVICTYHPNCLFF
TFYTNDWTVESQRNVCLLKTSKSGTPSSPTPQENALSGYSLLTCKRTLPEPCHSKIYTGV
DFGGEELNAIFVKGVSDCQETCTKMIRCQFFTYSLLPEDCRGEKCKCSLRLSMDGSPTRI
TYETQASSGYSLRLCKVGDDSDCTTKISARIVGGTNSSWGEWPWQVSLQVKLTAQSHVCG
GSIIKKQWVLTAAHCFDGLLFSDIWRIYGGILNLSEITKETPFSQIKEIIIHPNYNISES
THDIALIKLEAPLNYTEFQKPICLPSKDDTNTIYSNCWITGWGFTKEKGEIQNILQKANI
PLVTNEECQKRYRNYEITKQMICAGYKEGGKDACKGDSCGPLVCKHNGIWHLVGXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXGGE
Download sequence
Identical sequences ENSPVAP00000005532 ENSPVAP00000005532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]