SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000005585 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000005585
Domain Number 1 Region: 154-241
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000346
Family U-box 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000005585   Gene: ENSPVAG00000005904   Transcript: ENSPVAT00000005903
Sequence length 244
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3355:112414:303053:1 gene:ENSPVAG00000005904 transcript:ENSPVAT00000005903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRSSSNSGSTGFISFSSVESALSSLKNFQSCISSGMDTASSVALDLVETQTEVSSEYS
MDKAMVEFAMMDRELNHYVKAVQSAINHVKEERPEKIPDLKLLVEKKFLALQNKNSDADF
QNNEKFVQFKQQLELKKYGLQADREADGTEGVDEDMIVTQSQTNFICPITQLEMKKPVKN
KVCGHTYEEEAIVRMIESKHKRRKKACCPKIGCIHTDVRMSDLIQDEALIRAIESHKKKH
RPSE
Download sequence
Identical sequences ENSPVAP00000005585 ENSPVAP00000005585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]