SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000006840 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000006840
Domain Number 1 Region: 137-216
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.000038
Further Details:      
 
Domain Number 2 Region: 237-317
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000033
Further Details:      
 
Domain Number 3 Region: 328-414
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.7e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000464
Further Details:      
 
Domain Number 4 Region: 429-501
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.5e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000006840   Gene: ENSPVAG00000007251   Transcript: ENSPVAT00000007251
Sequence length 714
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1430:154554:165188:-1 gene:ENSPVAG00000007251 transcript:ENSPVAT00000007251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDYSTGGPPPGPPPPAGGGGGSGGAGGAGGGPPPGPPGAGDRGGGGPGGGGPGGGAAGG
PSQPPGGGGPGIRKDAFADAVQRARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQ
PESKKLASQGDSISSQLGPIHPPPRTSMTEEYRVPDGMVGLIIGRGGEQINKIQQDSGCK
VQISPDSGGLPERSVSLTGAPESVQKAKMMLDDIVSRGRGGPPGQFHDNANGGQNGTVQE
IMIPAGKAGLVIGKGGETIKQLQERAGVKMILIQDGSQNTNVDKPLRIIGDPYKVQQACE
MVMDILRERDQGGFGDRNEYGSRIGGGIDVPVPRHSVGVVIGRSGEMIKKIQNDAGVRIQ
FKQDDGTGPEKIAHIMGPPDRCEHAARIINDLLQSLRSGPPGPPGGPGMPPGGRGRGRGQ
GNWGPPGGEMTFSIPTHKCGLVIGRGGENVKAINQQTGAFVEISRQLPPNGDPNFKLFVI
RGSPQQIDHAKQLIEEKIEGPLCPVGPGPGGPGPAGPMGPFNPGPFNQGPPGAPPHAGGP
PPHQYPPQGWGNTYPQWQPPAPHDPNKAAAAAADPNAAWAAYYSHYYQQPPGPVPGPAPA
PAAPPAQGEPPQPPPTGQSDYTKAWEEYYKKIGQQPQQPGAPPQQDYTKAWEEYYKKQAQ
VATGGGPGAPPGSQPDYSAAWAEYYRQQAAYYGQTPGPGGPQPPPTQQGQQQAQ
Download sequence
Identical sequences ENSPVAP00000006840 ENSPVAP00000006840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]