SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007555 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007555
Domain Number 1 Region: 127-203
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.94e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 
Domain Number 2 Region: 263-352
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000526
Family Eukaryotic type KH-domain (KH-domain type I) 0.0029
Further Details:      
 
Domain Number 3 Region: 896-938
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000569
Family SAM (sterile alpha motif) domain 0.02
Further Details:      
 
Domain Number 4 Region: 76-128
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007555   Gene: ENSPVAG00000008004   Transcript: ENSPVAT00000008004
Sequence length 974
Comment pep:novel genescaffold:pteVam1:GeneScaffold_1251:63851:284926:1 gene:ENSPVAG00000008004 transcript:ENSPVAT00000008004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQGEPGYLAAHSDPGSNSERSTDSPMPGSEDDLVAGAPLHSPEWSEERFRVDRKKLEA
MLQAAAEGKGKSGEDFFQKIMEETNTQIAWPSKLKIGAKSKKDPHIKVSGKKEDVKEAKE
MIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMEETGCHIHFPDSNRNNQAEKS
NQVSIAGQPAGVESARVRIRELLPLVLMFELPIAGILQPVPDPNSPSIQHISQTYNISVS
FKQRSRMYGATVIVRGSQNNTSAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMM
GRNGSNIKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTIESVCLARQYLMGCLPLVLMFDM
KEEIEVDPQFIAQLMEQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLESS
GVTIATSPSPASCPAGLACPSLDILASAGLGLTGLGLLGPTTLSLNTSTTPNSLLNALNS
SVSPLQSPSSGTPSPTLWAPPLANTSSATGFSAIPHLMIPSTAQATLTNILLSGVPAYGH
TAPSPPPGLTPVDVHINSMQTEGKKISPSLNGHAQSPNIKYGAISTSSLGEKVLSANHSD
PSRQSSGSEQASPKSNPVEGCNDAFVEVGMPRSPSHSGNAGDLKQMIGPSKVSCAKRQTV
ELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERARLASR
PSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRANH
VSYKPTMTTTFEGSSVSLSRSNSREHLGNGSESDNWRDRNGIGPASHSEFAASVGSPKRK
QNKSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQEID
LQTFLTLTDQDLKELGITTFGARRKMLLAISELNKNRRKLFEPPNARTSFLEGGASGRLP
RQYHSDIASVSGRW
Download sequence
Identical sequences ENSPVAP00000007555 ENSPVAP00000007555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]