SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007890 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007890
Domain Number 1 Region: 351-411
Classification Level Classification E-value
Superfamily Leucine zipper domain 2.08e-18
Family Leucine zipper domain 0.0000413
Further Details:      
 
Domain Number 2 Region: 19-49
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000033
Family Classic zinc finger, C2H2 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007890   Gene: ENSPVAG00000008353   Transcript: ENSPVAT00000008354
Sequence length 502
Comment pep:novel scaffold:pteVam1:scaffold_5160:2120:53631:-1 gene:ENSPVAG00000008353 transcript:ENSPVAT00000008354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRLRVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIVR
SKIEEPSVVETTHKDSPLSESTTSDKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSV
IIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVP
AAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGSGLV
RTQSEESRPQSLQQPATSTTETPASPAHTTPQTQNTSGRRRRAANEDPDEKRRKFLERNR
AAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPVTAM
QKKSGYHTADKDDSSEDLSVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQ
STEPALSQIVMAPSSQSQPSGS
Download sequence
Identical sequences ENSPVAP00000007890 ENSPVAP00000007890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]