SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000007959 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000007959
Domain Number 1 Region: 157-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 118-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.05e-18
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000007959
Domain Number - Region: 439-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000173
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000007959   Gene: ENSPVAG00000008428   Transcript: ENSPVAT00000008428
Sequence length 474
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3811:22495:24279:1 gene:ENSPVAG00000008428 transcript:ENSPVAT00000008428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKESDPKEAILEDRPSMGVVVEGPTRTGVWGSASEGVGTQGDPVGRQQGKAGLPKRRELS
QDLDPACLDFEAFVNRSFGLVPLRSEGLGGEGTLPASVSRKNFSGAVGLGPRLCAERKPH
ECRQCGKAFGRSSSLVKHQRIHSGYKPFACDVCGKHFIERSSLTIHQRVHTGEKPYACAD
CGKAFSQRMNLVVHQRTHTGEKLYACTECGKAXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXIKDSLTVHGRVHTGRYRCSECGKTFSRNHLTRHRIHT
Download sequence
Identical sequences ENSPVAP00000007959 ENSPVAP00000007959

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]