SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009204 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPVAP00000009204
Domain Number - Region: 15-63
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0357
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009204   Gene: ENSPVAG00000009766   Transcript: ENSPVAT00000009766
Sequence length 493
Comment pep:novel genescaffold:pteVam1:GeneScaffold_64:5234:18525:1 gene:ENSPVAG00000009766 transcript:ENSPVAT00000009766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAVMGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLYTGPGLAIHCMQV
HKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQESQKKKQQDDSDEYD
DDDSAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPLMPGVPPLMPGMPPV
MPGMPPGLHHQRKYTQSFCGENIMMPMGGMMPPGPGIPPLMPGMPPGLPPPVPRPGIPPM
TQAQAVSAPGILNRPPAPTAAVPAPQPPVTKPLFPSAGQMGTPVTSSSTASSNSESLSAS
SKALFPSTAQAQAAVQGPVGTDFKPLNSTPATTTEPPKPTFPAYTQSTASTTSTTNSTAA
KPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGP
IGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGGMPPYGQGPPMVPPYQGGPP
RPPMGMRPPVMSQ
Download sequence
Identical sequences ENSPVAP00000009204 ENSPVAP00000009204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]