SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000009740 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000009740
Domain Number 1 Region: 95-163
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.9e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 2 Region: 11-75
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000701
Family Eukaryotic type KH-domain (KH-domain type I) 0.0025
Further Details:      
 
Domain Number 3 Region: 335-381
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000555
Family RING finger domain, C3HC4 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000009740   Gene: ENSPVAG00000010333   Transcript: ENSPVAT00000010334
Sequence length 387
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3881:187036:191642:-1 gene:ENSPVAG00000010333 transcript:ENSPVAT00000010334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSSNTTECVPVSFTSEHVAEIVGRQGCKIKALRAKTNTYIKTPVRGEEPVFMVTGRREDV
ATARREIISAAEHFSMIRASRNKSGAAFGVAPALPGQVTIRVRVPYRVVGLVVGPKGATI
KRIQQQTNTYIITPSRDRDPVFEITGAPGNVERAREEIETHIAVRTGKILEYNNENDFLA
GSPDPALDSRYSEAWRVHPPGCKPLSTFRQNSLGCIGECAVDSGFEAPRLGEQGGDFGYG
GYLFPGYGVGKQDVYYGVAETSPPLWAGQENATPTSVLFSSSSATKARAGPPGAHRSPAT
SSELAGLPRRPPGEPLQGFSKLGGGGLRSPGGGRDCMVCFESEVTAALVPCGHNLFCMEC
AVRICERTDPECPVCHITATQAIRIFS
Download sequence
Identical sequences ENSPVAP00000009740 ENSPVAP00000009740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]