SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000010648 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000010648
Domain Number 1 Region: 217-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.26e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 2 Region: 337-421
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.55e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 3 Region: 430-502
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000131
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 4 Region: 136-212
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000438
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000010648
Domain Number - Region: 75-125
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0427
Family Canonical RBD 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000010648   Gene: ENSPVAG00000011295   Transcript: ENSPVAT00000011295
Sequence length 520
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2411:21046:103518:-1 gene:ENSPVAG00000011295 transcript:ENSPVAT00000011295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KVELHGKLIEVEHSVPKRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXALDKLNGFQLENFTLKVAFIPDEMAAQQNPSQQPRGRRGFGQRGS
SRQGSPGSVSKPKPCDLPLRLLVPTQFVGAIIGKEGATIRNFTKQTQSKIDVHRKENAGA
AEKSITILSTPEGTSAACKSILEIMHKEAQDIKFTEEIPLKILAHNNFVGRLIGKEGRNL
KKIEQDTDTKITISPLQELTLYNPERTITVKGSVETCAKAEEEIMKKIRESYENDIASMN
LQAHLIPGLNLNALGLFPPTSGMPPPTSGPPSAMTPPYPQFEQSETETVHLFIPALSVGA
IIGKQGQHIKQLSRFAGASIKIAPAEAPDAKVRMVIITGPPEAQFKAQGRIYGKIKEENF
VSPKEEVKLEAHIRVPSFAAGRVIGKGGKTVNELQNLSSAEVVVPRDQTPDENDQVVVKI
TGHFYACQVAQRKIQEILTQVKQHQQQKALQSGPPQSRRK
Download sequence
Identical sequences ENSPVAP00000010648 ENSPVAP00000010648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]