SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011394 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011394
Domain Number 1 Region: 1797-1845
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000384
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 188-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000466
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011394   Gene: ENSPVAG00000012091   Transcript: ENSPVAT00000012091
Sequence length 2444
Comment pep:novel genescaffold:pteVam1:GeneScaffold_68:73310:94897:-1 gene:ENSPVAG00000012091 transcript:ENSPVAT00000012091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTGDTALGQKATSRSGETDKASGRWRQEQSAVIKMSTFGSQEGQRQPQIDPEQGNTASA
QLFGSGKLASPSEMTQQVPEKQYPPHRPSPYSCQHSLSFPQHSLPQGVMHSSKPHQSLEG
PPWLFPGPLPSIASEDLFPFPIHGHSGGYPRKKISNLNPAFSQYSQKSIEQSEDAHKKEH
KPKKPGKYICPYCSRACAKPSVLKKHIRSHTGERPYPCIPCGFSFKTKSNLYKHRKSHAH
AIKAGLVPFTESAVAKLDLEAGFIDVEAEIHSDGEQSTDTDEESSLFVEPSDKMSPGPPV
PLDIASRVGYRGSLEESLGGPMKVPILIIPKSGIPLPNESSQYFGSDILPNPTLNTKADD
SHTVKQKLALRLSEKKGQDSEPSLNLLSPHSKGSTDSGYFSRSESAEQQISPPNTNAKSY
EEIIFGKYCRLSPRNTLSVTTASQERATMGRKGMMEPLPHVNTRLEVKMFEDPVSQLIPS
KGDIDPIQTSMLKSTKFNSESRQSQTVPPSIRNEGKLYPANFQGSNPVLLEAPVDSSPLI
RSNSMPTSSATNLSIPPSLRGSHSFDERMTGSDDVFYPGTVGIPPQRMLRRQAAFELPSV
QEGHVEAEHHGRMLKSISGSSLKEKKLIPGDRVGYDYDVCRKPYKKWEDSETPKQSYRDI
SCLSSLKHGGEYFMDPSVPLQGMPTMFGTTCENRKRRKEKSVGDEEDTPMICSSVVSAPM
GIMTSDYDPKLQMQEGMRGGFAVAGHENPSHGHSERFDPCRPQLQSGSPSLGSEESPSAT
DSDKMSDLGGRKPPGNVISVIQHTNSLSRPNSFERSESSELVASAQDKAPSPSETCDSEI
SEAPVSPEWAPLGDGTDSGGKPSPSQQVQQPSYHAQPRLVRQHNIQVPEIRVTEEPDKPE
KEKEAQSKEPEKPVEEFQWPQRSETLSQLPAEKLPPKKKRLRLADMEHSSGESSFESTGT
GLSRSPSQESNLSHSSSFSMSFEREETIKLAAPGKQDELGKHSEFLTVPAGSYSLSVPGH
HHQKEMRRCSSEQMPCPHPTEVPEIRSKSFDYGNLSHAPVAGASTSTLSPSRERKKCFLV
RQASFSGSPEIAQGEAGADLGVKQEQIEHLHAGLRSTWHHAPSSVLPPLQAEDPGKQVVG
PCAQLSSGPLHLAQQQVMHMDSQESLRNPLIQPTSYISSKHLPEQPHLFPHQETIPFSPI
QNALFQFQYPTVCMVHLPAQQPPWWQAHFPHPLAPHPQKSYGKPSFQAEIHPSYPLEHAA
EHTGKKAPEYAHAKEQTYPCYSGTSGLHSKNLLPKFPSDQSTKSVDTPSEQVLQEDFALA
NAGPLQSLPGTVVPVRIQTHVPSYGSVMYTSISQILGQNSPAIVICKVDENMTQRTLVTS
ATMQGIGFNIAQVLGQHAGLEKYPIWKVPQTLPLGLESSIPLCLPSTSDSVASLGGSKRM
LSPASSLELFMETKQQKRVKEEKMYGQIVEELSAVELTNSDIKKDLSRPQKPQLVRQGCA
SEPKDGLQSGSSSFSSLSPSSSQDHPSASMPSREPSPSXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIKPDASFLFGSKL
ERKLVGNILKERGKGDIHGDKDIGSKHTEPIRIKIFEGGYKSNEDYVYVRGRGRGKYICE
ECGIRCKKPSMLKKHIRTHTDVRPYVCKLCNFAFKTKGNLTKHMKSKAHMKKCLELGVSM
TSVDDTETEEAETMEDLHKAAEKHSMSSISTDHQFSDAEESDGEDGDDIDDDDEDDDDFD
DQGDLTPKTRSRSTSPQPPRFSSLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXDSEPDKDRLDIPSCMDEECMLSSEPSSSPRDFSPS
SHHSSPGYDSSPCRDNSPKRYLIPKGDLSPRRHLSPRRDLSPMRHLSPRKEAALRREMSQ
RDVSPRRHLSPRRPLSPGKDITARRDISPRRERKYMTSIRAPSPRRALYHNPPLSMGQYL
QAEPIVLGPPNLRRGLPQVPYFSLYGDQEGAYDHPGSSLFPEGPNDYVFSHLPLHSQQQV
RAPIPMVPVGGIQMVHSMPPALSGLHPPPTLPLPMDGSEEKKGASGEPFAKDPYIISKQH
EKPSPHILQSSGPPSLPSSPRLLMKQSTSEDSLNATEREQEENIQTCTKAIASLRIATEE
AALLGADQPVRVQDPHQKPSGSAHVSIRHFSGPEPGQPCTSATHPDLHDGEKDNFGTSQT
ALAHSTFYSKSCVDDKQSGFHGSKELPSSTEEGKEPLSEKSQLH
Download sequence
Identical sequences ENSPVAP00000011394 ENSPVAP00000011394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]