SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011758 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011758
Domain Number 1 Region: 253-328
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.75e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.00013
Further Details:      
 
Domain Number 2 Region: 67-94,146-197
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000948
Family Eukaryotic type KH-domain (KH-domain type I) 0.0043
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000011758
Domain Number - Region: 12-53
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00014
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011758   Gene: ENSPVAG00000012474   Transcript: ENSPVAT00000012474
Sequence length 420
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3128:48286:50793:-1 gene:ENSPVAG00000012474 transcript:ENSPVAT00000012474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPRCPSLVLYPQSSARITISEGSCPERITTITGSTAAVFHAVSMIAFKLDEDLCSATANG
GNISRPPVTLRLVIPASQCGSLIGKAGTKIKEIREVRGRGSYPGAPPSVAGGGLGSWPHP
PRGSESGQPFSGLWEQPEVASVLCLQTTGAQVQVAGDLLPNSTERAVTVSGVPDAIILCV
RQICAVILESPPKGATIPYHPSLSLGTVLLSANQGFSVQGQYGAVTPAEVTKLQQLSGHA
VPFASPGMVPGLDPGAQTSSQEFLVPNDLIGCVIGRQGSKISEIRQMSGAHIKIGNQAEG
AGERHVTITGSPVSIALAQYLITACLETAKSTSGGTPGSAPADLPAPFSPPLTALPTAPP
GLLGTPYAISLSNFIGLKPVPFLALPPASPGPPPGLAAYTAKMAAANGSKKAERQKFSPY
Download sequence
Identical sequences ENSPVAP00000011758 ENSPVAP00000011758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]