SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011775 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000011775
Domain Number 1 Region: 38-280
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.49e-52
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 281-322
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000116
Family SOCS box-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011775   Gene: ENSPVAG00000012491   Transcript: ENSPVAT00000012491
Sequence length 323
Comment pep:novel genescaffold:pteVam1:GeneScaffold_673:255522:277956:-1 gene:ENSPVAG00000012491 transcript:ENSPVAT00000012491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGPVFSGFKNIFITMFATFFFFKLLIKVFLALLTHFYIVKGNRKEAARIAEEIYSGIS
DCWADRSPLHEAAAQGRLLALKTLIAQGVNVNLVTINRVSSLHEACLGGHVACARALLEN
GARVNGVTVHGATPLFNACCSGSAACVNVLLEFGAKAQLEVHLASPIHEAVKRGHRECME
ILLANNVNIDQEVPQHGTPLYVACTHQRVDCVKKLLELGANVDCGQCLDTPLHAAVRQSR
VEVVHLLIDYGANLKCRNAQGKSALDLAAPKSSMEQALLIREGPPALSQLCRLCVRKCLG
RACHQTIHKLHLPEPLQRFLLYR
Download sequence
Identical sequences ENSPVAP00000011775 ENSPVAP00000011775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]