SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000011989 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPVAP00000011989
Domain Number - Region: 25-93
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000892
Family Eukaryotic type KH-domain (KH-domain type I) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000011989   Gene: ENSPVAG00000012712   Transcript: ENSPVAT00000012712
Sequence length 116
Comment pep:novel genescaffold:pteVam1:GeneScaffold_3888:11703:12616:-1 gene:ENSPVAG00000012712 transcript:ENSPVAT00000012712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTLLKRKDIPPWVRVPEDLKDPEVFLVQTRLLEAMFGPDGSRIPYIEQVSKAMLELKVL
ESSDFTEVVVYGNYLYKLRTKWMLQSMAERHRLRQERGMLKLEEAMNALELGPSMK
Download sequence
Identical sequences L5JLD2
ENSPVAP00000011989 ENSPVAP00000011989 XP_006926447.1.64745 XP_011379313.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]