SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012042 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012042
Domain Number 1 Region: 639-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000878
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 2 Region: 528-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000114
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 597-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000208
Family Classic zinc finger, C2H2 0.051
Further Details:      
 
Domain Number 4 Region: 219-335
Classification Level Classification E-value
Superfamily SET domain 0.0000523
Family Histone lysine methyltransferases 0.084
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000012042
Domain Number - Region: 345-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000136
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number - Region: 771-795,829-854
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000511
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Domain Number - Region: 692-757
Classification Level Classification E-value
Superfamily Expressed protein At2g23090/F21P24.15 0.00123
Family Expressed protein At2g23090/F21P24.15 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012042   Gene: ENSPVAG00000012764   Transcript: ENSPVAT00000012767
Sequence length 1156
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2235:102586:149405:-1 gene:ENSPVAG00000012764 transcript:ENSPVAT00000012767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSKDESSHVWPTSAEHEENAAQVHFVPDAGTVAQIVYTDDQVRPPPQVVYTADGASYTS
VDGPEHTLVYIHPVEAAQTLFTDPGQVAYVQQDATAQQASLPVHNQVLPSIESVDGSDPL
ATLQNPMGRLEAKEEEDEDEDEDTEEDEEEDGEDTDLDDWGPDPPRPFDPHDLWCEECNN
AHSSVCPKHGPLHPIPNRPVLTRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPL
VRESELKDCYIHLKVSLDKGDRKDRDLHEDLWFELSDETLCNWMMFVRPAENHLEQNLVA
YQYGHHVYYTTIKNVEPKQELKVWYAASYAEFVNQKIHDISEEERKVLREQEKNWPCYEC
NRRFISSEQLQQHLNSHDEKLDVFSRTRGRGRGRGKRRFGPGRRPGRPPKFIRLEITSEN
GEKCDDGTQDLLHFSPKEQFDEAEPATLNGLDQPEQNTLPIPQLPQETPSSLEHEPEAHS
LHLQPQLEESVLPTPSTLTADDMRRAKRIRVIFQNAALQHLFIRKSFRPFKCLQCGKAFR
EKDKLDQHLRFHGREGNCPLTCDLCNKGFISSASLESHMKLHSDQKTYSCIFCPESFDRL
DLLKDHVAIHINDGYFTCPTCKKRFPDFIQVKKHVRSFHSEKIYQCTECDKAFCRPDKLR
LHMLRHSDRKDFLCSTCGKQFKRKDKLREHMQRMHNPEREAKKADRISRSKTFKPRITST
DYDSFTFKCRLCMMGFRRRGMLVNHLSKRHPDMKIEEVPELTLPIIKPNRDYFCQYCDKV
YKSASKRKAHILKNHPGAELPPSIRKLRPAGPGEPDPMLSTHTQLTGTIATPPVCCPHCS
KQYSSKTKMVQHIRKKHPEYAQLPNTLHTPLTTAVISATPAVLTTDSATGETVVTTDLLT
QAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSTSGLQQPQHIQLQVVQVAPATSPHQSQQ
STVDVGQLHDPQTYTQHAIQVQHIQVTEPTASAPSSSQVAGQPLSPSSQQSQQGLSPTHI
QGSSSAPGQALQQQQQSSSVQHTYLPNAWNSFRGYSSEIQMMTLPPGQFVITDSGVATPV
TTGQVKAVTPGHYVLSESQPELEERQASALSGGVQIQPTAHSDLDPQTTSQQQPTQYIIT
TTTNGNGSSEVHITKP
Download sequence
Identical sequences ENSPVAP00000012042 ENSPVAP00000012042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]