SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012504 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012504
Domain Number 1 Region: 268-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000458
Family Classic zinc finger, C2H2 0.047
Further Details:      
 
Domain Number 2 Region: 10-60
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000236
Family Chaperone J-domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012504   Gene: ENSPVAG00000013255   Transcript: ENSPVAT00000013258
Sequence length 542
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2908:3791:21538:1 gene:ENSPVAG00000013255 transcript:ENSPVAT00000013258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KNLDNAAEAAEQFKLIQAAYDVLSDPQERAWYDNHREALLKGGLDGEYQDDSLDLLHYFT
VTCYSGYGDDEKGFYTVYRNVFEMIAKEELESVLEEDAEGFPTFGDSQSDYDTVVHPFYA
YWQSFCTQKNFAWKEEYDTRQASNRWEKRAMEKENKKTRDKARKEKNELVRQLVAFIRKR
DKRVQAHRKLVEEQNAEKARKAEEMRRQQKLRQAKLAEQYKEQSWMTVADLEKELREMEA
RYEKEFGDGSDENEMEEHELKDGQDGKDSDEAEDAELYDGLYCPACDKSFKTEKAMRNHE
KSKKHREMVALLKQQLEEEEENFSGPQTDENLLNANSEEEMEDAPKQKLSKKQKKKKQKP
AQTITDEVSYLPAAHSSWGKCVCRIREEERKSKRGKILLKTKRKQSYDDNFNENGTGEGL
KVDPEDTNLNQDSAKGLEDSPQENVSDTETVQLCDDPKNEAKSVSKPKGKKAKDTKKSVK
VPAEPQTMNDVLISCTTCHSEFPSRNKLFDHLKATGHARAPSSSSLNSVTSSRSKKEKRK
NR
Download sequence
Identical sequences ENSPVAP00000012504 ENSPVAP00000012504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]