SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012624 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012624
Domain Number 1 Region: 216-281
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000139
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000219
Further Details:      
 
Domain Number 2 Region: 285-331,400-428
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000535
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000012624
Domain Number - Region: 61-116
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0476
Family Chromo barrel domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012624   Gene: ENSPVAG00000013386   Transcript: ENSPVAT00000013385
Sequence length 631
Comment pep:novel genescaffold:pteVam1:GeneScaffold_675:8319:48757:1 gene:ENSPVAG00000013386 transcript:ENSPVAT00000013385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPERQIPFHDVRFPPPVGYNKDIN
ESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPKKP
ATKDTFHKIKLDVPEDLRQMCAKESAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKR
AHMLIDMHFRSLRTKLSLILRNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHGAN
IQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKN
GKLIQEIVDKSGVVRVRIEAENEKNVPQEEEIMPPNSLPPSNSRIGPTPSEDKKHIDIKE
NSAHFSQPNSTKVQRVLVVSSIVAGESQKPELKAWQGMVPFVFVGTKDSIANATVLLDYH
LNYLEVDQLRLERLQIDEQLRQIGASSRPPPNRTDKEKGYVTDDGQGMGRGSRPYRNRGH
GRRGPGYTSGTNSEASNASETESDHRDELSDWSLAPTEEERENFLRRGDGRRRGGGGRGQ
GGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIRVDCNNERSVHTKTLQNTSSE
GNRLRTGKDRNQKKEKPDSVDGPQPLVNGVP
Download sequence
Identical sequences ENSPVAP00000012624 ENSPVAP00000012624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]