SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000012674 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000012674
Domain Number 1 Region: 369-426
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 425-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.77e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 313-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.16e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 257-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 467-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 219-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000012674   Gene: ENSPVAG00000013438   Transcript: ENSPVAT00000013438
Sequence length 526
Comment pep:novel scaffold:pteVam1:scaffold_13154:26146:34247:-1 gene:ENSPVAG00000013438 transcript:ENSPVAT00000013438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTADLRESMALAPWGPVTVKKEEEEEGNFLGQASSQQVHSENVKVWAPGEGLQTGLDGAE
QEAKGQNIFWDMAVVLKATQEVPAVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXGLSSGVKNQRIQAGQKPFSCSVCGKGFSQSANLVVHQ
RIHTGEKPFECHECGKAFIQSANLVVHQRIHTGQKPYVCSKCGKAFTQSSNLTVHQKIHS
LEKTFKCSECEKAFSYSSQLARHQKVHITEKCYECNECGKTFTRSSNLIVHQRIHTGEKP
FACNDCGKAFTQSANLIVHQRSHTGEKPYECKECGKAFSCFSHLIVHQRIHTAEKPYDCS
ECGKAFSQLSCLIVHQRIHSGDLPYVCNECGKAFTCSSYLLIHQRIHNGEKPYTCNECGK
AFRQRSSLTVHQRTHTGEKPYECEKCGAAFISNSHLMRHHRTHLVE
Download sequence
Identical sequences ENSPVAP00000012674 ENSPVAP00000012674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]