SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013795 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013795
Domain Number 1 Region: 166-197
Classification Level Classification E-value
Superfamily WW domain 0.000000000254
Family WW domain 0.001
Further Details:      
 
Domain Number 2 Region: 125-157
Classification Level Classification E-value
Superfamily WW domain 0.00000000188
Family WW domain 0.00026
Further Details:      
 
Domain Number 3 Region: 9-50
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000277
Family HkH motif-containing C2H2 finger 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013795   Gene: ENSPVAG00000014634   Transcript: ENSPVAT00000014634
Sequence length 373
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2913:158794:177640:1 gene:ENSPVAG00000014634 transcript:ENSPVAT00000014634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADYWKSQPKKFCDYCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEK
ASKEFAAMEAAALKAYQEDLKRLGLESEITEPATSPVTSTVPPTPTSGSNQKEKKKKKKD
PSKGRWVEGITSEGYHYYYDLITGASQWEKPEGFQGNLKKTAAKAIWVEGLSEDGYTYYY
NTETGESRWEKPDDFIPHTGDLSSSKVNEKALGTVEESKSSDSHSGSDGEQKAEKGEVST
QTPKLKIKFKEKNKNSVKGTEPEKQKEKNIQEENSSGPKEEKSKAHKKSNPYGEWQEIKQ
EVESHEEVDLELPSPENEYVSTSEAEAGEPKVVFKEKTVTSLGVMADGVAPVFKKRRTEN
GKSRNLRQRGDDQ
Download sequence
Identical sequences ENSPVAP00000013795 ENSPVAP00000013795 XP_011368038.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]