SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000013882 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000013882
Domain Number 1 Region: 91-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-26
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 137-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 53-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.34e-18
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000013882   Gene: ENSPVAG00000014727   Transcript: ENSPVAT00000014726
Sequence length 225
Comment pep:novel scaffold:pteVam1:scaffold_4590:35088:35765:-1 gene:ENSPVAG00000014727 transcript:ENSPVAT00000014726 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGKPKGGISRSSSQGRTSENQRKTGRQRQKWGMTIRFDSSLSRLRRSLDEKPYKCTEC
EKSFSQSSTLFQHQKIHTGKKSHKCVDCGKSFFQSSNLIQHRRIHTGEKPYKCDECGERF
KQSSNLIQHQRIHTGEKPYQCDECGRCFSQSSHLIQHQRTHTGEKPYQCSECGKCFSQSS
HLRQHTKVHKEEKPRRTRGKNIRAKTHLVSSWKAGTGRKSVAGLR
Download sequence
Identical sequences ENSPVAP00000013882 ENSPVAP00000013882 XP_006908444.1.64745 XP_011376441.1.92234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]