SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000015385 from Pteropus vampyrus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000015385
Domain Number 1 Region: 226-295
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000097
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000519
Further Details:      
 
Domain Number 2 Region: 296-366
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000198
Family Eukaryotic type KH-domain (KH-domain type I) 0.003
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000015385
Domain Number - Region: 67-180
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0202
Family MBT repeat 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000015385   Gene: ENSPVAG00000016306   Transcript: ENSPVAT00000016306
Sequence length 697
Comment pep:novel genescaffold:pteVam1:GeneScaffold_2550:50504:65792:-1 gene:ENSPVAG00000016306 transcript:ENSPVAT00000016306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGLASGGDVEPGLPVEVRGSNGAFYKGFVKDVHEDSVTIFFENNWQSERQIPFGDVRLP
PPADYNKEITEGDEVEVYSRANEQEPCGWWLARVRMMKGDFYVIEYAACDATYNEIVTLE
RLRPVNPNPLATKGSFFKVTMAVPEDLREACSNENVHKEFKKALGANCIFLNITNSELFI
LSTTEAPVKRASLLGDMHFRSLRTKLLLMSRNEEATKHLETSKQLAAAFQEEFTVREDLM
GLAIGTHGANIQQARKVPGVTAIELGEETCTFRIYGETPEACRQARSYLEFSEDSVQVPR
NLVGKVIGKNGKVIQEIVDKSGVVRVRVEGDNDKKNPREEGMVPFIFVGTRENISNAQAL
LEYHLSYLQEVEQLRLERLQIDEQLRQIGLGFRPPGSGRGSGGSDKAGYTTDESSSSSLH
TTRTYGGSYGGRGRGRRTGGPAYGPSSDPSTASETESEKREEPTRAGPGDRDPPTRGEEN
RRRPTGGRGRGPPPAPRPTSRYNSSSISSVLKDPDSNPYSLLDTSEPEPPIDSEPGEPPP
ASARRRRSRRRRTDEDRTVMDGGLESDGPGMTENGLEDESRPQRRNRSRRRRNRGNRTDG
SISGDRQPVTVADYISRAESQSRQRPPLERTKPSEDPLSGQKGDSVSKLPKGPSENGELS
APLELGSLEWGFIKPPARIPPFSISLAAQHHGPHRPD
Download sequence
Identical sequences ENSPVAP00000015385 ENSPVAP00000015385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]